A database of hormones and their receptors

Home

Hormone Peptide Non-peptide Search Search Browse Browse H-R Pair H-R Pair

Receptor Search Browse

Tools BLAST Domain Search Peptide Mapping Structure Search

Miscellaneous Online Submission HMRbase Information Supplementary Information Recent Information Help

Contact

Peptide Hormone

Search Result - 1

HMRbase accession number	10100
Swiss-prot Accession number	P81032 (Sequence in FASTA format)
Description	Crustacean hyperglycemic hormone (CHH).
Source organism	Cancer pagurus (Rock crab)
Taxonomical Classification	Eukaryota; Metazoa; Arthropoda; Crustacea; Malacostraca;Eumalacostraca; Eucarida; Decapoda; Pleocyemata; Brachyura;Eubrachyura; Cancroidea; Cancridae; Cancer.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the arthropod CHH/MIH/GIH/VIH hormone family.
Tissue Specificity	Produced by the medulla terminalis X-organ in the eyestalks and transported to the sinus gland where they are stored and released
Post translational modification	The N-terminus forms pyrrolidone carboxylic acid in isoform CHH-II and is free in isoform CHH-I.
Function	Hormone found in the sinus gland of isopods and decapods which controls the blood sugar level. Has a secretagogue action over the amylase released from the midgut gland. May act as a stress hormone and may be involved in the control of molting and reproduction
Protein Length	72 Amino acids
Molecular weight	8442
References	1  PubMed abstract 9809792
Domain Name	Crust_neurohorm
Hormone Name	Crustacean hyperglycemic hormone
Mature Hormone Sequence	QIYDTSCKGVYDRGLFSDLEHVCDDCYNLYRNSYVASACRSNCYSNVVFRQCMEELLLMDEFDKYARAVQIV
Position of mature hormone in Pre-Hormone protein	72 Residues from position (1-72)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 2

HMRbase accession number	10132
Swiss-prot Accession number	P81034 (Sequence in FASTA format)
Description	Mandibular organ-inhibiting hormone 1 (MOIH-1).
Source organism	Cancer pagurus (Rock crab)
Taxonomical Classification	Eukaryota; Metazoa; Arthropoda; Crustacea; Malacostraca;Eumalacostraca; Eucarida; Decapoda; Pleocyemata; Brachyura;Eubrachyura; Cancroidea; Cancridae; Cancer.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the arthropod CHH/MIH/GIH/VIH hormone family.
Tissue Specificity	Produced by the medulla terminalis X-organ in the eyestalks and transported to the sinus gland where it is stored and released
Post translational modification	N/A
Function	Represses the synthesis of methyl farnesoate, the precursor of insect juvenile hormone III in the mandibular organ
Protein Length	78 Amino acids
Molecular weight	9241
References	1  PubMed abstract 8662685
Domain Name	Crust_neurohorm
Hormone Name	Mandibular organ-inhibiting hormone 1
Mature Hormone Sequence	RRINNDCQNFIGNRAMYEKVDWICKDCANIFRKDGLLNNCRSNCFYNTEFLWCIDATENTRNKEQLEQWAAILGAGWN
Position of mature hormone in Pre-Hormone protein	78 Residues from position (1-78)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 3

HMRbase accession number	10133
Swiss-prot Accession number	P81035 (Sequence in FASTA format)
Description	Mandibular organ-inhibiting hormone 2 (MOIH-2).
Source organism	Cancer pagurus (Rock crab)
Taxonomical Classification	Eukaryota; Metazoa; Arthropoda; Crustacea; Malacostraca;Eumalacostraca; Eucarida; Decapoda; Pleocyemata; Brachyura;Eubrachyura; Cancroidea; Cancridae; Cancer.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the arthropod CHH/MIH/GIH/VIH hormone family.
Tissue Specificity	Produced by the medulla terminalis X-organ in the eyestalks and transported to the sinus gland where it is stored and released
Post translational modification	N/A
Function	Represses the synthesis of methyl farnesoate, the precursor of insect juvenile hormone III in the mandibular organ
Protein Length	78 Amino acids
Molecular weight	9241
References	1  PubMed abstract 8662685
Domain Name	Crust_neurohorm
Hormone Name	Mandibular organ-inhibiting hormone 2
Mature Hormone Sequence	RRINNDCQNFIGNRAMYEKVDWICKDCANIFRQDGLLNNCRSNCFYNTEFLWCIDATENTRNKEQLEQWAAILGAGWN
Position of mature hormone in Pre-Hormone protein	78 Residues from position (1-78)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 4

HMRbase accession number	10469
Swiss-prot Accession number	P55846 (Sequence in FASTA format)
Description	Molt-inhibiting hormone (MIH).
Source organism	Cancer pagurus (Rock crab)
Taxonomical Classification	Eukaryota; Metazoa; Arthropoda; Crustacea; Malacostraca;Eumalacostraca; Eucarida; Decapoda; Pleocyemata; Brachyura;Eubrachyura; Cancroidea; Cancridae; Cancer.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the arthropod CHH/MIH/GIH/VIH hormone family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Inhibits Y-organs where molting hormone (ecdysteroid) is secreted. A molting cycle is initiated when MIH secretion diminishes or stops. Has also significant hyperglycemic hormone (CHH) activity
Protein Length	78 Amino acids
Molecular weight	9200
References	1  PubMed abstract 8868306
Domain Name	Crust_neurohorm
Hormone Name	Molt-inhibiting hormone
Mature Hormone Sequence	RVINDDCPNLIGNRDLYKKVEWICEDCSNIFRNTGMATLCRKNCFFNEDFLWCVYATERTEEMSQLRQWVGILGAGRE
Position of mature hormone in Pre-Hormone protein	78 Residues from position (1-78)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated